Synuclein-Gamma


Background

Catalog Number:

CPTC-SNCG-1

RRID:

AB_10572387

Target Antigen:

Synuclein-Gamma

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

05/28/2024

Antigen Recognition(s):

Recombinant Full-length, Endogenous

SOP:

Purchase
External Links
Publications
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry
Click to enlarge image Affinity and binding kinetics of CPTC-SNCG-1 antibody and SNCG recombinant protein using biolayer interferometry. CPTC-SNCG-1 antibody was covalently immobilized on amine-reactive second-generation sensors. SNCG recombinant protein, 256 nM, 64 nM, 16 nM, 4.0 nM, 1 nM and 0.25 nM, was used as analyte. Click image to enlarge

CPTC-SNCG-1 Affinity and Kinetics

Result: Positive

Affinity and binding kinetics of CPTC-SNCG-1 antibody and SNCG recombinant protein using biolayer interferometry. CPTC-SNCG-1 antibody was covalently immobilized on amine-reactive second-generation sensors. SNCG recombinant protein, 256 nM, 64 nM, 16 nM, 4.0 nM, 1 nM and 0.25 nM, was used as analyte.


  Affinity Measurement by SPR
Click to enlarge image Affinity and binding kinetics of CPTC-SNCG-1 antibody and SNCG recombinant protein using surface plasmon resonance. CPTC-SNCG-1 antibody was amine coupled onto a Series S CM5 biosensor chip. SNCG recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM and 4 nM, was used as analyte. Click image to enlarge

CPTC-SNCG-1 Affinity and Kinetics

Result: Positive

Affinity and binding kinetics of CPTC-SNCG-1 antibody and SNCG recombinant protein using surface plasmon resonance. CPTC-SNCG-1 antibody was amine coupled onto a Series S CM5 biosensor chip. SNCG recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM and 4 nM, was used as analyte.


  CyTOF
Click to enlarge image Imaging mass cytometry on ovarian cancer tissue core using CPTC-SNCG-1 metal-labeled antibody.  Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, and lung). Click image to enlarge

CPTC-SNCG-1 Immuno-Mass Cytometry

Result: Positive

Imaging mass cytometry on ovarian cancer tissue core using CPTC-SNCG-1 metal-labeled antibody. Data shows an overlay of the target protein signal (red) and DNA (blue). Dilution: 1:100 of 0.5mg/mL stock. Signal was also obtained in other normal tissues (colon, pancreas, breast, lung, testis, endometrium, appendix, and kidney) and cancer tissues (breast, colon, ovarian, and lung).


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (139.3 KB)

CPTC-SNCG-1 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-SNCG-1 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-SNCG-1 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence

CPTC-SNCG-1 Immunofluorescence

Result: Negative

Immunofluorescence staining of human cell line MCF7 with CPTC-SNCG-1 Ab shows no localization of SNCG protein.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SNCG-1 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-SNCG-1 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SNCG-1 as primary Ab against Ag 10504 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SNCG-1 Western Blot

Result: Positive

Western Blot using CPTC-SNCG-1 as primary Ab against Ag 10504 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-SNCG-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. Colorimetric detection. Negative for all cell lines. Click image to enlarge

CPTC-SCNG-1 Lysates WB

Result: Negative

Western Blot using CPTC-SNCG-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. Colorimetric detection. Negative for all cell lines.


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated Western Blot using CPTC-SNCG-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. Colorimetric detection. Negative for all cell lines. Click image to enlarge

CPTC-SNCG-1 Lysates automated WB

Result: Negative

Automated Western Blot using CPTC-SNCG-1 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. Colorimetric detection. Negative for all cell lines.


  Western Blot - Tissue or Cell Lysate

CPTC-SNCG-1 Single Cell Western Blot (Cell Lysate)

Result: Negative

Single cell western blot using CPTC-SNCG-1 as a primary antibody against MCF7 cell lysate. SNCG protein expression was not detected.


Background

Catalog Number:

CPTC-SNCG-2

RRID:

AB_2302330

Target Antigen:

Synuclein-Gamma

Isotype:

IgG2c

Species:

Mouse Monoclonal Antibody

Last Updated:

02/14/2022

Antigen Recognition(s):

Recombinant Full-length

SOP:

Purchase
Characterization Data [Compare Characterization Data]
  Affinity Measurement by Biolayer Interferometry

CPTC-SNCG-2 Affinity and Kinetics

Result: Negative

Affinity and binding kinetics of CPTC-SNCG-2 antibody and SNCG recombinant protein using biolayer interferometry. CPTC-SNCG-2 antibody was covalently immobilized on amine-reactive second-generation sensors. SNCG recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM, 4.0 nM, 1 nM and 0.25 nM, was used as analyte.


  Affinity Measurement by SPR

CPTC-SNCG-2 Affinity and Kinetics

Result: Negative

Affinity and binding kinetics of CPTC-SNCG-2 antibody and SNCG recombinant protein using surface plasmon resonance. CPTC-SNCG-2 antibody was amine coupled onto a Series S CM5 biosensor chip. SNCG recombinant protein, 1024 nM, 256 nM, 64 nM, 16 nM, 4 nM, 1 nM, 0.25 nM and 0.0625 nM, was used as analyte.


  IHC HPA
Download This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org) (128.5 KB)

CPTC-SNCG-2 Evaluation by the Human Protein Atlas

Result: Positive

This PDF contains the evaluation results provided by the Human Protein Atlas (www.proteinatlas.org)


  IHC NCI60

CPTC-SNCG-2 IHC NCI60

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  IHC Tissue

CPTC-SNCG-2 IHC Tissue

Result: Negative

This antibody is not suitable for use in an Immunohistochemistry format as described in SOP M-106.


  Immunofluorescence

CPTC-SNCG-2 Immunofluorescence

Result: Negative

Immunofluorescence staining of human cell line MCF7 with CPTC-SNCG-2 Ab shows no localization of SNCG protein.


  Indirect ELISA
Click to enlarge image Indirect ELISA (ie, binding of Antibody to Antigen coated plate) Click image to enlarge

CPTC-SNCG-2 Indirect ELISA

Result: Positive

Indirect ELISA (ie, binding of Antibody to Antigen coated plate)


Characterization SOP Files

  NCI 60 Protein Array

CPTC-SNCG-2 NCI 60 Protein Array

Result: Negative

This antibody is not suitable for use in a Reverse Phase Protein Array format as described in SOP M-105.


  Western Blot - Recombinant Protein or Peptide
Click to enlarge image Western Blot using CPTC-SNCG-2 as primary Ab against Ag 10504 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3). Click image to enlarge

CPTC-SNCG-2 Western Blot

Result: Positive

Western Blot using CPTC-SNCG-2 as primary Ab against Ag 10504 (lane 2). Also included are molecular wt. standards (lane 1) and mouse IgG control (lane 3).


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Western Blot using CPTC-SNCG-2 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. ECL detection. Positive for cell lines HeLa, Jurkat, A549 and MCF7. Click image to enlarge

CPTC-SNCG-2 Lysates WB

Result: Presumed Positive (with additional bands)

Western Blot using CPTC-SNCG-2 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. ECL detection. Positive for cell lines HeLa, Jurkat, A549 and MCF7.


  Western Blot - Tissue or Cell Lysate
Click to enlarge image Automated Western Blot using CPTC-SNCG-2 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. Colorimetric detection. Negative for all cell lines. Click image to enlarge

CPTC-SNCG-2 Lysates Automated WB

Result: Negative

Automated Western Blot using CPTC-SNCG-2 as primary Ab against cell lysate from HeLa, Jurkat, A549, MCF7 and H226 cells (lane 2-6). Also included are molecular wt. standards (lane 1). Expected MW is 13 KDa. Colorimetric detection. Negative for all cell lines.


  Western Blot - Tissue or Cell Lysate

CPTC-SNCG-2 Single Cell Western Blot (Cell Lysate)

Result: Negative

Single cell western blot using CPTC-SNCG-2 as a primary antibody against MCF7 cell lysate. SNCG protein expression was not detected.


Background

NCI Identification Number:

10504

Antigen Name:

Synuclein-Gamma

CPTC Name:

CPTC-SNCG

Aliases:

SNCG; BCSG1; PERSYN; PRSN; SR; Synoretin; OTTHUMP00000020013

Function:

Synuclein-gamma is a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. High levels of SNCG have been identified in advanced breast carcinomas suggesting a correlation between overexpression of SNCG and breast tumor development.

Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity)

Chromosomal Localization:

10q23.2-q23.3

Expression System:

E. Coli

Accession Number:

BC014098

UniProt Accession Number:

O76070

DNA Source:

HIP : HsCD00004878

Immunogen:

Recombinant Full Length Protein

Vector Name:

pMCSG7

Extinction Coefficient:

1490

Buffers:

50mM NH4HC03

Expressed Sequence:

SNAMDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKEN
VVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRK
EDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Native Sequence:

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQ
SVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDL
RPSAPQQEGEASKEKEEVAEEAQSGGD

Calculated Isoelectric Point:

4.89

Molecular Weight:

13603

Last Updated:

08/22/2020

Links

Characterization Data

Gel

Click to enlarge image PAGE of antigen CPTC-SNCG with molecular weight standards in Lane 1
Click image to enlarge

CPTC-SNCG

PAGE of antigen CPTC-SNCG with molecular weight standards in Lane 1

SOPs

Don't have Adobe Reader��?

Get it for free at Adobe.com